TNIK monoclonal antibody (M03), clone 3D4

• Catalog Number: orb2291364
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant TNIK.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: TNIK (AAH55427, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MKKVTDYSSSSEESESSEEEEEDGESETHDGTVAVSDIPRLIPTGAPGSNEQYNVGMVGTHGLETSHADSFSGSISREGTLMIRETSGEKKRSGHSDSNGFAGHINLPDL
• Tested applications: ELISA, WB
• Clone Number: 3D4
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH55427

Detection limit for recombinant GST tagged TNIK is 0.3 ng/ml as a capture antibody.

Western Blot analysis of TNIK expression in transfected 293T cell line by TNIK monoclonal antibody (M03), clone 3D4. Lane 1: TNIK transfected lysate(60.3 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (37.73 KDa).