TNFSF14 monoclonal antibody (M01), clone 4E3

• Catalog Number: orb2291839
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant TNFSF14.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: TNFSF14 (AAH18058, 61 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: LHWRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGVAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRT
• Tested applications: ELISA, IHC-P, IP, WB
• Clone Number: 4E3
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH18058

Detection limit for recombinant GST tagged TNFSF14 is approximately 1 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to TNFSF14 on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3 ug/ml]

Immunoprecipitation of TNFSF14 transfected lysate using anti-TNFSF14 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TNFSF14 MaxPab rabbit polyclonal antibody.

Western Blot analysis of TNFSF14 expression in transfected 293T cell line by TNFSF14 monoclonal antibody (M01), clone 4E3. Lane 1: TNFSF14 transfected lysate (22.4 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (37.73 KDa).