TLR8 monoclonal antibody (M01), clone 4C6

• Catalog Number: orb2291145
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant TLR8.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4C6
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2b Kappa
• Immunogen: TLR8 (NP_619542, 723 a.a. ~ 825 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: RISHLPSGFLSEVSSLKHLDLSSNLLKTINKSALETKTTTKLSMLELHGNPFECTCDIGDFRRWMDEHLNVKIPRLVDVICASPGDQRGKSIVSLELTTCVSD
• NCBI: NP_619542
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

TLR8 monoclonal antibody (M01), clone 4C6 Western Blot analysis of TLR8 expression in HL-60.

Western Blot analysis of TLR8 expression in transfected 293T cell line by TLR8 monoclonal antibody (M01), clone 4C6. Lane 1: TLR8 transfected lysate(121.764 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (37.33 KDa).