TLR2 Antibody

SKU: orb153339

Description

Goat polyclonal antibody to TLR2. It is a 84 kDa type I transmembrane glycoprotein and a member of TLR family. It contains many leucine-rich repeat sequences and the intracellular Toll Interleukin Receptor Domain. TLR2 forms heterodimer with TLR1 and TLR6. It is expressed in peripheral blood leukocytes, and highly expressed in monocytes in bone marrow, lymph nodes, and spleen. It is also detectable in other tissues. This protein recognizes molecular patterns of bacteria, fungi, protozoan pathogens and stimulates pro-inflammatory cytokines as part of innate immunity.

Images & Validation

• Tested Applications: WB
• Dilution Range: WB:1:500-1:2,000
• Reactivity: Human, Monkey, Mouse, Rat
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 736 aa to the C-terminus of human TLR2 produced in E. coli. Antigen Sequence: LLEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRAAIKS
• Target: Toll-like receptor 2
• Purification: Epitope affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Form/Appearance: Polyclonal antibody supplied as a 200 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
• Concentration: Please inquire
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

CD282, TIL4, toll/interleukin 1 receptor-like 4, toll/interleukin-1 receptor-like protein 4 antibody.

Western blot analysis of MDA-MB-4355 cell line lysate using TLR2 antibody.

Quick Database Links

Gene Symbol

Toll-like receptor 2