You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2290779 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant TLR10. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 2A11 |
Tested applications | ELISA, WB |
Reactivity | Human, Mouse, Rat |
Isotype | IgG1 Kappa |
Immunogen | TLR10 (NP_112218.2, 1 a.a. ~ 811 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | DAPELPEERELMTNCSNMSLRKVPADLTPATTTLDLSYNLLFQLQSSDFHSVSKLRVLILCHNRIQQLDLKTFEFNKELRYLDLSNNRLKSVTWYLLAGLRYLDLSFNDFDTMPICEEAGNMSHLEILGLSGAKIQKSDFQKIAHLHLNTVFLGFRTLPHYEEGSLPILNTTKLHIVLPMDTNFWVLLRDGIKTSKILEMTNIDGKSQFVSYEMQRNLSLENAKTSVLLLNKVDLLWDDLFLILQFVWHTSVEHF |
NCBI | NP_112218.2 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
TLR10 monoclonal antibody (M01), clone 2A11 Western Blot analysis of TLR10 expression in PC-12.
TLR10 monoclonal antibody (M01), clone 2A11. Western Blot analysis of TLR10 expression in NIH/3T3.
TLR10 monoclonal antibody (M01), clone 2A11. Western Blot analysis of TLR10 expression in Raw 264.7.
Western Blot detection against Immunogen (87.27 KDa).