TLR10 monoclonal antibody (M01), clone 2A11

• Catalog Number: orb2290779
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant TLR10.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2A11
• Tested applications: ELISA, WB
• Reactivity: Human, Mouse, Rat
• Isotype: IgG1 Kappa
• Immunogen: TLR10 (NP_112218.2, 1 a.a. ~ 811 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: DAPELPEERELMTNCSNMSLRKVPADLTPATTTLDLSYNLLFQLQSSDFHSVSKLRVLILCHNRIQQLDLKTFEFNKELRYLDLSNNRLKSVTWYLLAGLRYLDLSFNDFDTMPICEEAGNMSHLEILGLSGAKIQKSDFQKIAHLHLNTVFLGFRTLPHYEEGSLPILNTTKLHIVLPMDTNFWVLLRDGIKTSKILEMTNIDGKSQFVSYEMQRNLSLENAKTSVLLLNKVDLLWDDLFLILQFVWHTSVEHF
• NCBI: NP_112218.2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

TLR10 monoclonal antibody (M01), clone 2A11 Western Blot analysis of TLR10 expression in PC-12.

TLR10 monoclonal antibody (M01), clone 2A11. Western Blot analysis of TLR10 expression in NIH/3T3.

TLR10 monoclonal antibody (M01), clone 2A11. Western Blot analysis of TLR10 expression in Raw 264.7.

Western Blot detection against Immunogen (87.27 KDa).