You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292052 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant TLN1. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 5C1 |
Tested applications | ELISA, IHC-P, WB |
Reactivity | Human, Mouse, Rat |
Isotype | IgG3 Kappa |
Immunogen | TLN1 (NP_006280, 1052 a.a. ~ 1149 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | SALSVVQNLEKDLQEVKAAARDGKLKPLPGETMEKCTQDLGNSTKAVSSAIAQLLGEVAQGNENYAGIAARDVAGGLRSLAQAARGVAALTSDPAVQA |
NCBI | NP_006280 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged TLN1 is approximately 0.03 ng/ml as a capture antibody.
Immunoperoxidase of monoclonal antibody to TLN1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]
TLN1 monoclonal antibody (M05), clone 5C1. Western Blot analysis of TLN1 expression in PC-12.
TLN1 monoclonal antibody (M05), clone 5C1. Western Blot analysis of TLN1 expression in Raw 264.7.
Western Blot detection against Immunogen (36.52 KDa).