TLN1 monoclonal antibody (M05), clone 5C1

• Catalog Number: orb2292052
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant TLN1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 5C1
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human, Mouse, Rat
• Isotype: IgG3 Kappa
• Immunogen: TLN1 (NP_006280, 1052 a.a. ~ 1149 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: SALSVVQNLEKDLQEVKAAARDGKLKPLPGETMEKCTQDLGNSTKAVSSAIAQLLGEVAQGNENYAGIAARDVAGGLRSLAQAARGVAALTSDPAVQA
• NCBI: NP_006280
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged TLN1 is approximately 0.03 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to TLN1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]

TLN1 monoclonal antibody (M05), clone 5C1. Western Blot analysis of TLN1 expression in PC-12.

TLN1 monoclonal antibody (M05), clone 5C1. Western Blot analysis of TLN1 expression in Raw 264.7.

Western Blot detection against Immunogen (36.52 KDa).