TIMM9 monoclonal antibody (M01), clone 1D6

• Catalog Number: orb2291255
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant TIMM9.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human, Mouse, Rat
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: TIMM9 (AAH20213, 1 a.a. ~ 89 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MAAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLLGQPR
• Tested applications: ELISA, IHC-P, WB
• Clone Number: 1D6
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH20213

Detection limit for recombinant GST tagged TIMM9 is approximately 0.1 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to TIMM9 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]

TIMM9 monoclonal antibody (M01), clone 1D6 Western Blot analysis of TIMM9 expression in IMR-32.

TIMM9 monoclonal antibody (M01), clone 1D6. Western Blot analysis of TIMM9 expression in NIH/3T3.

TIMM9 monoclonal antibody (M01), clone 1D6. Western Blot analysis of TIMM9 expression in PC-12.

TIMM9 monoclonal antibody (M01), clone 1D6. Western Blot analysis of TIMM9 expression in Raw 264.7.

Western Blot analysis of TIMM9 expression in transfected 293T cell line by TIMM9 monoclonal antibody (M01), clone 1D6. Lane 1: TIMM9 transfected lysate(10.4 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (35.53 KDa).