You have no items in your shopping cart.
Cart summary
Item 1 of 3
Item 1 of 3
TIMM8A purified MaxPab mouse polyclonal antibody (B01P)
Catalog Number: orb2293655
| Catalog Number | orb2293655 |
|---|---|
| Category | Antibodies |
| Description | Mouse polyclonal antibody raised against a full-length human TIMM8A protein. |
| Species/Host | Mouse |
| Clonality | Polyclonal |
| Tested applications | IF, WB |
| Reactivity | Human |
| Immunogen | TIMM8A (NP_004076.1, 1 a.a. ~ 97 a.a) full-length human protein. |
| Conjugation | Unconjugated |
| Protein Sequence | MDSSSSSSAAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFIDTSQFILNRLEQTQKSKPVFSESLSD |
| NCBI | NP_004076.1 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Immunofluorescence of purified MaxPab antibody to TIMM8A on HeLa cell. [antibody concentration 10 ug/ml]
TIMM8A MaxPab polyclonal antibody. Western Blot analysis of TIMM8A expression in HepG2.
Western Blot analysis of TIMM8A expression in transfected 293T cell line by TIMM8A MaxPab polyclonal antibody. Lane 1: TIMM8A transfected lysate (10.67 KDa). Lane 2: Non-transfected lysate.
