TIMM8A monoclonal antibody (M01), clone 2F11

• Catalog Number: orb2293654
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant TIMM8A.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2F11
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: TIMM8A (NP_004076, 9 a.a. ~ 97 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: AAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFIDTSQFILNRLEQTQKSKPVFSESLSD
• NCBI: NP_004076
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged TIMM8A is approximately 0.3 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to TIMM8A on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml]

TIMM8A monoclonal antibody (M01), clone 2F11 Western Blot analysis of TIMM8A expression in HeLa.

Western Blot analysis of TIMM8A expression in transfected 293T cell line by TIMM8A monoclonal antibody (M01), clone 2F11. Lane 1: TIMM8A transfected lysate (11 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (35.53 KDa).