You have no items in your shopping cart.
Cart summary
TIMM23 Recombinant Protein (Human)
Catalog Number: orb2051031
| Catalog Number | orb2051031 |
|---|---|
| Category | Proteins |
| Description | TIMM23 Recombinant Protein (Human) |
| Tag | N-terminal GST-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 48.9 kDa |
| UniProt ID | O14925 |
| Protein Sequence | MEGGGGSGNKTTGGLAGFFGAGGAGYSHADLAGVPLTGMNPLSPYLNVDPRYLVQDTDEFILPTGANKTRGRFELAFFTIGGCCMTGAAFGAMNGLRLGLKETQNMAWSKPRNVQILNMVTRQGALWANTLGSLALLYSAFGVIIEKTRGAEDDLNTVAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHMKGSLLQQSL |
| Source | E.coli |
| NCBI | NP_006318 |
| Storage | -20°C or -80°C |
| Buffer/Preservatives | Liquid or Lyophilized powder |
| Alternative names | mitochondrial import inner membrane translocase su Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Human TIMM23 protein [orb54559]
Greater than 90% as determined by SDS-PAGE.
48.9 kDa
E.coli
20 μg, 100 μg, 1 mgTIMM23 Recombinant Protein (Human) [orb2051029]
Greater than 90% as determined by SDS-PAGE.
48.9 kDa
E.coli
20 μgTIMM23 Recombinant Protein (Human) [orb2051030]
Greater than 90% as determined by SDS-PAGE.
48.9 kDa
E.coli
1 mg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
