You have no items in your shopping cart.
Cart summary
THY1 Recombinant Protein (Mouse)
Catalog Number: orb2053190
| Catalog Number | orb2053190 |
|---|---|
| Category | Proteins |
| Description | THY1 Recombinant Protein (Mouse) |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 28.8 kDa |
| UniProt ID | P01831 |
| Protein Sequence | QKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREKRKHVLSGTLGIPEHTYRSRVTLSNQPYIKVLTLANFTTKDEGDYFCELQVSGANPMSSNKSISVYRDKLVKC |
| Source | E.coli |
| NCBI | NP_033408 |
| Storage | -20°C or -80°C |
| Buffer/Preservatives | Liquid or Lyophilized powder |
| Alternative names | CD90;T25;Thy-1;thy-1 antigen;thy-1 membrane glycop Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Mouse Thy1 protein [orb383068]
Greater than 90% as determined by SDS-PAGE.
28.8 kDa
E.coli
20 μg, 100 μg, 1 mgTHY1 Recombinant Protein (Mouse) [orb2053189]
Greater than 90% as determined by SDS-PAGE.
28.8 kDa
E.coli
20 μgTHY1 Recombinant Protein (Mouse) [orb2053191]
Greater than 90% as determined by SDS-PAGE.
28.8 kDa
E.coli
100 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
