You have no items in your shopping cart.
Cart summary
Thrombospondin-2/THBS2 Protein, Mouse, Recombinant (E. coli, His)
Catalog Number: orb1976988
| Catalog Number | orb1976988 |
|---|---|
| Category | Proteins |
| Description | Adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions. Ligand for CD36 mediating antiangiogenic properties. Thrombospondin-2/THBS2 Protein, Mouse, Recombinant (E. coli, His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 28.1 kDa and the accession number is Q03350. |
| Tag | N-6xHis |
| Purity | 98.00% |
| MW | 28.1 kDa (predicted) |
| UniProt ID | Q03350 |
| Protein Sequence | GDHVKDTSFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRFDYIPPVNTDDLNRIVKLARRKEGFFLTAQLKQDRKSRGTLLVLEGPGTSQRQFEIVSNGPGDTLDLNYWVEGNQHTNFLEDVGLADSQWKNVTVQVASDTYSLYVGCDLIDSVTLEEPFYEQLEVDRSRMYVAKGASRESHFRGLLQNVHLVFADSVEDILSKKGCQHSQGA |
| Expression System | E. coli |
| Biological Origin | Mouse |
| Biological Activity | Adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions. Ligand for CD36 mediating antiangiogenic properties. Thrombospondin-2/THBS2 Protein, Mouse, Recombinant (E. coli, His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 28.1 kDa and the accession number is Q03350. |
| Expression Region | 19-232 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
