TGOLN2 monoclonal antibody (M02), clone 2F11

• Catalog Number: orb2291521
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant TGOLN2.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: TGOLN2 (NP_006455, 229 a.a. ~ 327 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: QGPIDGPSKSGAEEQTSKDSPNKVVPEQPSRKDHSKPISNPSDNKELPKADTNQLADKGKLSPHAFKTESGEETDLISPPQEEVKSSEPTEDVEPKEAE
• Tested applications: ELISA, IF, IHC-P, WB
• Clone Number: 2F11
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_006455

Detection limit for recombinant GST tagged TGOLN2 is 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to TGOLN2 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to TGOLN2 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]

Western Blot detection against Immunogen (36.63 KDa).