TGF beta Receptor II/TGFBR2 Antibody

• Catalog Number: orb334561
• Category: Antibodies
• Description: TGF beta Receptor II/TGFBR2 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human TGFBR2 (96-128aa TLETVCHDPKLPYHDFILEDAASPKCIMKEKKK), different from the related mouse sequence by five amino acids, and from the related rat sequence by eight amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 64568 MW
• UniProt ID: P37173
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: TGF-beta receptor type-2;TGFR-2;2.7.11.30;TGF-beta
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of TGFBR2 using anti-TGFBR2 antibody.Lane 1:MCF-7 Cell;2:SW620 Cell;3:22RV1 Cell;4:HELA Cell.