TGF beta 1 antibody

• Catalog Number: orb576457
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TGF beta 1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IF, IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Goat, Guinea pig, Mouse, Porcine, Rat, Sheep
• Reactivity: Animal, Bovine, Canine, Goat, Guinea pig, Mouse, Porcine, Rat, Sheep
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse TGFB1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 43kDa
• Target: TGFB1
• UniProt ID: P04202
• Protein Sequence: Synthetic peptide located within the following region: DTPEWLSFDVTGVVRQWLNQGDGIQGFRFSAHCSCDSKDNKLHVEINGIS
• NCBI: NP_035707
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: Tgfb, Tgfb-1, TGFbeta, TGF-beta, TGFbeta1, TGF-bet
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of Human Fetal Heart using TGF Beta1 antibody.