TFAP2A monoclonal antibody (M01), clone 2G5

• Catalog Number: orb2292067
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant TFAP2A.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: TFAP2A (AAH17754, 99 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: SGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVF
• Tested applications: ELISA, IHC-P, WB
• Clone Number: 2G5
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH17754
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged TFAP2A is approximately 1 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to TFAP2A on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1 ug/ml]

Western Blot analysis of TFAP2A expression in transfected 293T cell line by TFAP2A monoclonal antibody (M01), clone 2G5. Lane 1: TFAP2A transfected lysate (48.1 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of TFAP2A over-expressed 293 cell line, cotransfected with TFAP2A Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TFAP2A monoclonal antibody (M01), clone 2G5 (Cat # orb2292067). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (37.4 KDa).