TECTA Antibody

• Catalog Number: orb389510
• Category: Antibodies
• Description: TECTA Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human TECTA (93-134aa RAFVAPFWADVHNGIRGEIYYRETMEPAILKRATKDIRKYFK), different from the related mouse sequence by three amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 239527 MW
• UniProt ID: O75443
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Alpha-tectorin;TECTA;
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of TECTA using anti-TECTA antibody.Lane 1:rat testis tissue;2:mouse HEPA1-6 cell;3:human HepG2 cell.

IHC analysis of TECTA using anti-TECTA antibody. TECTA was detected in a paraffin-embedded section of human testis tissue.

IHC analysis of TECTA using anti-TECTA antibody. TECTA was detected in a paraffin-embedded section of human lung cancer tissue.

IHC analysis of TECTA using anti-TECTA antibody. TECTA was detected in a paraffin-embedded section of human intetsinal cancer tissue.