TBX2 monoclonal antibody (M01), clone 7G5

• Catalog Number: orb2292092
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant TBX2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 7G5
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG3 Kappa
• Immunogen: TBX2 (NP_005985, 603 a.a. ~ 702 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: GSARPRLRFSPYQIPVTIPPSTSLLTTGLASEGSKAAGGNSREPSPLPELALRKVGAPSRGALSPSGSAKEAANELQSIQRLVSGLESQRALSPGRESPK
• NCBI: NP_005985
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged TBX2 is approximately 0.3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to TBX2 on HeLa cell. [antibody concentration 30 ug/ml]

TBX2 monoclonal antibody (M01), clone 7G5 Western Blot analysis of TBX2 expression in Hela S3 NE.

Western Blot analysis of TBX2 expression in transfected 293T cell line by TBX2 monoclonal antibody (M01), clone 7G5. Lane 1: TBX2 transfected lysate (74.1 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of TBX2 over-expressed 293 cell line, cotransfected with TBX2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TBX2 monoclonal antibody (M01), clone 7G5 (Cat # orb2292092). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (36.74 KDa).