You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291768 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant TBX18. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 4D3 |
Tested applications | ELISA, IF, WB |
Reactivity | Human, Mouse, Rat |
Isotype | IgG2a Kappa |
Immunogen | TBX18 (XP_496819, 454 a.a. ~ 560 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | STLLQGTGNGVPATHPHLLSGSSCSSPAFHLGPNTSQLCSLAPADYSACARSGLTLNRYSTSLAETYNRLTNQAGETFAPPRTPSYVGVSSSTSVNMSMGGTDGDTF |
NCBI | XP_496819 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Immunofluorescence of monoclonal antibody to TBX18 on HeLa cell. [antibody concentration 10 ug/ml]
TBX18 monoclonal antibody (M06), clone 4D3 Western Blot analysis of TBX18 expression in Hela S3 NE.
TBX18 monoclonal antibody (M06), clone 4D3. Western Blot analysis of TBX18 expression in NIH/3T3.
TBX18 monoclonal antibody (M06), clone 4D3. Western Blot analysis of TBX18 expression in PC-12.
Western Blot detection against Immunogen (37.77 KDa).