TAZ monoclonal antibody (M12), clone 1B10

• Catalog Number: orb2292095
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant TAZ.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1B10
• Tested applications: ELISA, WB
• Reactivity: Human, Rat
• Isotype: IgG2a Kappa
• Immunogen: TAZ (AAH11515, 1 a.a. ~ 262 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MPLHVKWPFPAVPPLTWTLASSVVMGLVGTYSCFWTSEWAQAEAGPPGYPCPAGGILKLRHIWNLKLMRWTPAAADICFTKELHSHFFSLGKCVPVCRGDGVYQKGMDFILEKLNHGDWVHIFPEGIGRLIAECHLNPIILPLWHVGEPGDGDREMASGVGGLGLPLVPGCPAPPHVWPSVHCAAGMNDVLPNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLHNHLQPGR
• NCBI: AAH11515
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged TAZ is approximately 3 ng/ml as a capture antibody.

TAZ monoclonal antibody (M12), clone 1B10 Western Blot analysis of TAZ expression in SW-13.

TAZ monoclonal antibody (M12), clone 1B10. Western Blot analysis of TAZ expression in human kidney.

TAZ monoclonal antibody (M12), clone 1B10. Western Blot analysis of TAZ expression in human uterus myoma.

TAZ monoclonal antibody (M12), clone 1B10. Western Blot analysis of TAZ expression in PC-12.

Western Blot detection against Immunogen (54.56 KDa).