TAX1BP3 monoclonal antibody (M01), clone 4A10

• Catalog Number: orb2291186
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant TAX1BP3.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: TAX1BP3 (AAH23980, 1 a.a. ~ 124 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS
• Tested applications: ELISA, WB
• Clone Number: 4A10
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH23980

Detection limit for recombinant GST tagged TAX1BP3 is approximately 0.1 ng/ml as a capture antibody.

Western Blot detection against Immunogen (39.38 KDa).