You have no items in your shopping cart.
Cart summary
TARC/CCL17 Protein, Canine, Recombinant (His & KSI)
Catalog Number: orb1979427
| Catalog Number | orb1979427 |
|---|---|
| Category | Proteins |
| Description | CCL17 Protein, Canine, Recombinant (His & KSI) is expressed in E. coli. |
| Tag | N-6xHis-KSI |
| Purity | 98.00% |
| MW | 23.9 kDa (predicted) |
| UniProt ID | Q95N01 |
| Protein Sequence | ARGTNVGRECCLEYFKGAIPISRLTRWYKTSGECPKDAIVFVTVQGKSICSDPKDKRVKKAVRYLQRTWKGGPQES |
| Expression System | E. coli |
| Biological Origin | Canine |
| Biological Activity | CCL17 Protein, Canine, Recombinant (His & KSI) is expressed in E. coli. |
| Expression Region | 24-99 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expiration Date | 6 months from date of receipt. |
