TANK Antibody

• Catalog Number: orb443223
• Category: Antibodies
• Description: TANK Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, IHC, IHC-Fr, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human TANK (MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQK).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml Immunohistochemistry (Frozen Section), 0.5-1μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 48 kDa
• UniProt ID: Q92844
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: TRAF family member-associated NF-kappa-B activator
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of A431 cells using anti-TANK antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of TANK using anti-TANK antibody.Lane 1:human HeLa Cell;2:human placenta tissue;3:human A549 Cell;4:human MDA-MB-453 Cell;5:human SW620 Cell;6:human 22RV1 Cell;7:human SW579 Cell.

WB analysis of TANK using anti-TANK antibody.Lane 1:rat brain tissue;2:rat lung tissue;3:rat spleen tissue;4:rat kidney tissue;5:mouse brain tissue;6:mouse lung tissue;7:mouse spleen tissue;8:mouse kidney tissue.

IHC analysis of TANK using anti-TANK antibody.TANK was detected in paraffin-embedded section of mouse liver tissues.

IHC analysis of TANK using anti-TANK antibody.TANK was detected in paraffin-embedded section of rat small intestine tissue.

IHC analysis of TANK using anti-TANK antibody.TANK was detected in paraffin-embedded section of rat spleen tissue.

IHC analysis of TANK using anti-TANK antibody.TANK was detected in paraffin-embedded section of human cholangiocarcinoma tissue.

IHC analysis of TANK using anti-TANK antibody.TANK was detected in paraffin-embedded section of human placenta tissue.

IHC analysis of TANK using anti-TANK antibody.TANK was detected in paraffin-embedded section of human rectal cancer tissue.

IHC analysis of TANK using anti-TANK antibody.TANK was detected in paraffin-embedded section of mouse kidney tissues.

IHC analysis of TANK using anti-TANK antibody.TANK was detected in frozen section of human placenta tissues.