Talin 2/TLN2 Antibody

• Catalog Number: orb371695
• Category: Antibodies
• Description: Talin 2/TLN2 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Gallus
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Talin 2 (1787-1822aa NPKAQHTHDAITEAAQLMKEAVDDIMVTLNEAASEV).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 271613 MW
• UniProt ID: Q9Y4G6
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Talin-2;TLN2;KIAA0320;
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of Talin 2 using anti-Talin 2 antibody.Lane 1:rat brain tissue; 2:mouse cardiac muscle tissue; 3:SMMC7721 cell.

IHC analysis of Talin 2 using anti-Talin 2 antibody. Talin 2 was detected in a paraffin-embedded section of mouse intestine tissue.

IHC analysis of Talin 2 using anti-Talin 2 antibody. Talin 2 was detected in a paraffin-embedded section of human intestinal cancer tissue.

IHC analysis of Talin 2 using anti-Talin 2 antibody. Talin 2 was detected in a paraffin-embedded section of rat intestine tissue.