TAGLN monoclonal antibody (M01), clone 1E2

• Catalog Number: orb2292102
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full-length recombinant TAGLN.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1E2
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: TAGLN (AAH04927, 1 a.a. ~ 201 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS
• NCBI: AAH04927
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged TAGLN is 0.3 ng/ml as a capture antibody.

Western Blot analysis of TAGLN expression in transfected 293T cell line by TAGLN monoclonal antibody (M01), clone 1E2. Lane 1: TAGLN transfected lysate (22.6 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (47.85 KDa).