TAF7 monoclonal antibody (M01), clone 2C5

• Catalog Number: orb2292096
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant TAF7.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2C5
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: TAF7 (AAH32737, 130 a.a. ~ 224 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: FIWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAENQGLDISSPGMSGHRQGHDSLEHDELREIFN
• NCBI: AAH32737
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged TAF7 is approximately 0.3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to TAF7 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to TAF7 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml]

Immunoperoxidase of monoclonal antibody to TAF7 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1 ug/ml]

TAF7 monoclonal antibody (M01), clone 2C5 Western Blot analysis of TAF7 expression in MCF-7.

Western Blot analysis of TAF7 expression in transfected 293T cell line by TAF7 monoclonal antibody (M01), clone 2C5. Lane 1: TAF7 transfected lysate (40.3 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of TAF7 over-expressed 293 cell line, cotransfected with TAF7 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TAF7 monoclonal antibody (M01), clone 2C5 (Cat # orb2292096). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (36.08 KDa).