You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291565 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant TACC3. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 6C4 |
Tested applications | ELISA, IHC-P, WB |
Reactivity | Human, Rat |
Isotype | IgG3 Kappa |
Immunogen | TACC3 (NP_006333, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MSLQVLNDKNVSNEKNTENCDFLFSPPEVTGRSSVLRVSQKENVPPKNLAKAMKVTFQTPLRDPQTHRILSPSMASKLEAPFTQDDTLGLENSHPVWTQK |
NCBI | NP_006333 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged TACC3 is 0.03 ng/ml as a capture antibody.
Immunoperoxidase of monoclonal antibody to TACC3 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]
TACC3 monoclonal antibody (M02), clone 6C4 Western Blot analysis of TACC3 expression in Hela S3 NE.
TACC3 monoclonal antibody (M02), clone 6C4. Western Blot analysis of TACC3 expression in PC-12.
Western Blot detection against Immunogen (36.74 KDa).