TACC3 monoclonal antibody (M02), clone 6C4

• Catalog Number: orb2291565
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant TACC3.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 6C4
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human, Rat
• Isotype: IgG3 Kappa
• Immunogen: TACC3 (NP_006333, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MSLQVLNDKNVSNEKNTENCDFLFSPPEVTGRSSVLRVSQKENVPPKNLAKAMKVTFQTPLRDPQTHRILSPSMASKLEAPFTQDDTLGLENSHPVWTQK
• NCBI: NP_006333
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged TACC3 is 0.03 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to TACC3 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]

TACC3 monoclonal antibody (M02), clone 6C4 Western Blot analysis of TACC3 expression in Hela S3 NE.

TACC3 monoclonal antibody (M02), clone 6C4. Western Blot analysis of TACC3 expression in PC-12.

Western Blot detection against Immunogen (36.74 KDa).