You have no items in your shopping cart.
Cart summary
Item 1 of 1
SYT11 (Human) Recombinant Protein (Q01)
Catalog Number: orb2285611
| Catalog Number | orb2285611 |
|---|---|
| Category | Proteins |
| Description | Human SYT11 partial ORF ( NP_689493, 84 a.a. - 139 a.a.) recombinant protein with GST-tag at N-terminal. |
| Clonality | Recombinant |
| Tested applications | AP, Array, ELISA, WB |
| Tag | GST |
| Antibody Type | Recombinant Antibody |
| Protein Sequence | GPGREGGRRNLLVDAAEAGLLSRDKDPRGPSSGSCIDQLPIKMDYGEELRSPITSL |
| NCBI | NP_689493 |
| Storage | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Buffer/Preservatives | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Note | For research use only |
| Application notes | Best use within three months from the date of receipt of this protein. |
| Expiration Date | 6 months from date of receipt. |
