SYP / Synaptophysin Antibody

• Catalog Number: orb1537420
• Category: Antibodies
• Description: SYP / Synaptophysin Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IF, IHC-P, WB
• Reactivity: Human, Mouse, Rat
• Isotype: IgG
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-250 of human SYP (NP_003170.1). AFMWLVSSSAWAKGLSDVKMATDPENIIKEMPVCRQTGNTCKELRDPVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFLRAPPGAPEKQPAPGDAY
• Dilution range: IF (1:50 - 1:200), IHC-P (1:100), WB (1:500 - 1:2000)
• Conjugation: Unconjugated
• Target: SYP / Synaptophysin
• Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Buffer/Preservatives: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol. PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Alternative names: SYP, MRX, Synaptophysin, MRXSYP
• Note: For research use only
• Application notes: Further information: The predicted MW is 20kDa/33kDa, while the observed MW by Western blot was 38kDa.
• Expiration Date: 12 months from date of receipt.