Swine CCL20 Recombinant Protein

• Catalog Number: orb1820850
• Category: Proteins
• Description: The Swine CCL20 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CCL20 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine CCL20 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CCL20 Specifications: (Molecular Weight: 13.1 kDa) (Amino Acid Sequence: ASNFDCCLRYTDHILHPRFIMGFTQQLANEACDINAIIFYTKKKLAVCADPQKIWVKQAVNILSQRVKKM) (Gene ID: 553951).
• Form/Appearance: Lyophilized
• Purity: 98%
• MW: 8.1 kDa
• Target: CCL20
• Entrez: 553951
• Protein Sequence: ASNFDCCLRYTDHILHPRFIMGFTQQLANEACDINAIIFYTKKKLAVCADPQKIWVKQAVNILSQRVKKM
• Protein Length: 70
• Source: Yeast
• Storage: -20°C
• Alternative names: LARC, Exodus-1
• Note: For research use only
• Expiration Date: 6 months from date of receipt.