SUR2A Antibody (APC)

SKU: orb150353

Description

Mouse monoclonal to SUR2A (APC). Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins are subunits of the inward-rectifier potassium ion channels Kir6. x (6. 1 and 6. 2). The association of four K ir6. x and four SUR subunits form an ion conducting channel commonly referred to as the K ATP channel. The primary function of the sulfonylurea receptor is to sense intracellular levels of the nucleotides ATP and ADP and in response facilitate the open or closing its associated Kir 6. x potassium channel. Hence the K ATP channel monitors the energy balance within the cell..

Research Area

Cancer Biology, Cell Biology, Disease Biomarkers, Neuroscience, Signal Transduction

Images & Validation

• Tested Applications: ICC, IF, IHC, WB
• Dilution Range: WB (1:1000)
• Reactivity: Human, Mouse, Rat
• Application Notes:
  1 µg/ml was sufficient for detection of SUR2A in 20 µg of mouse brain membrane lysate and assayed by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary antibody.

Key Properties

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2A
• Clone No.: N319A/14 (Formerly sold as S319A-14)
• Immunogen: Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A
• Target: SUR2A
• Molecular Weight: 120kDa
• Purification: Protein G Purified
• Conjugation: APC

Storage & Handling

• Storage: Conjugated antibodies should be stored according to the product label
• Buffer/Preservatives: 95.46mM Phosphate, 2.48mM MES and 2mM EDTA
• Concentration: 1 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

ABCC9, Sulfonylurea receptor 2, CMD10, ABC37, ATP-binding cassette transporter sub-family C member 9, Sulfonylurea receptor 2A, isoform SUR2A

Quick Database Links

Gene Symbol

SUR2A

UniProt

P70170

NCBI Gene ID

20928

RefSeq (Protein):NP_001038185.1