SUR1/ABCC8 Antibody

• Catalog Number: orb402415
• Category: Antibodies
• Description: SUR1/ABCC8 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human SUR1 (TIQREGTLKDFQRSECQLFEHWKTLMNRQDQELEKETVTERKA).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/mlImmunohistochemistry (Frozen Section), 0.5-1μg/ml Immunocytochemistry, 0.5-1μg/ml Flow Cytometry, 1-3μg/1x106 cells
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 177 kDa
• UniProt ID: Q09428
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: ATP-binding cassette sub-family C member 8; Sulfon
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of A431 cells using anti-ABCC8 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of SUR1 using anti-SUR1 antibody.Lane 1:human placenta tissue;2:rat brain tissue;3:mouse brain tissue.