Superoxide Dismutase 3/SOD3 Antibody

• Catalog Number: orb402479
• Category: Antibodies
• Description: Superoxide Dismutase 3/SOD3 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ICC, IF, IHC, WB
• Reactivity: Human
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human SOD3 (WTGEDSAEPNSDSAEWIRDMYAKVTEIWQEVMQRRDDD).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.25-0.5 μg/ml Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/ml Immunocytochemistry/Immunofluorescence, 5 μg/ml
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 33 kDa
• UniProt ID: P08294
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Extracellular superoxide dismutase [Cu-Zn]; EC-SOD
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of SOD3 using anti-SOD3 antibody.Lane 1:human PC-3 cell.

IF analysis of SOD3 using anti-SOD3 antibody. SOD3 was detected in an immunocytochemical section of PC-3 cells.

IHC analysis of SOD3 using anti-SOD3 antibody. SOD3 was detected in paraffin-embedded section of human mammary cancer tissue.

IHC analysis of SOD3 using anti-SOD3 antibody.SOD3 was detected in paraffin-embedded section of human lung cancer tissue.