You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2052180 |
---|---|
Category | Proteins |
Description | SULT1A1 Recombinant Protein (Rat) |
Tag | N-terminal 10XHis-SUMO-tagged and C-terminal Myc-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 53.9 kDa |
UniProt ID | P17988 |
Protein Sequence | MEFSRPPLVHVKGIPLIKYFAETIGPLQNFTAWPDDLLISTYPKSGTTWMSEILDMIYQGGKLEKCGRAPIYARVPFLEFKCPGVPSGLETLEETPAPRLLKTHLPLSLLPQSLLDQKVKVIYIARNAKDVVVSYYNFYNMAKLHPDPGTWDSFLENFMDGEVSYGSWYQHVKEWWELRHTHPVLYLFYEDIKENPKREIKKILEFLGRSLPEETVDSIVHHTSFKKMKENCMTNYTTIPTEIMDHNVSPFMRKGTTGDWKNTFTVAQNERFDAHYAKTMTDCDFKFRCEL |
Source | E.coli |
Storage | -20°C or -80°C |
Buffer/Preservatives | Liquid or Lyophilized powder |
Alternative names | Aryl sulfotransferase;Aryl sulfotransferase cytoso Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Greater than 90% as determined by SDS-PAGE. | |
53.9 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
53.9 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
53.9 kDa | |
E.coli |
ELISA, WB | |
Greater than 95% as determined by SDS-PAGE | |
31.9 kDa | |
E.Coli |
98.00% | |
53.9 kDa (predicted) |
Filter by Rating