You have no items in your shopping cart.
Cart summary
STX1A Peptide - N-terminal region
Catalog Number: orb1997756
| Catalog Number | orb1997756 |
|---|---|
| Category | Proteins |
| Description | STX1A Peptide - N-terminal region |
| Predicted Reactivity | Mouse |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | Synthetic peptide located within the following region: KDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENV |
| UniProt ID | O35526 |
| MW | 33 kDa |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | HPC-1 |
| Note | For research use only |
| NCBI | NP_058081.2 |
