STK38 monoclonal antibody (M04), clone 2F3

• Catalog Number: orb2291400
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant STK38.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human, Mouse, Rat
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: STK38 (AAH12085, 365 a.a. ~ 465 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: EHRIGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILKPTVATSNHPETDYKNKDWVFINYTYKRFEGLTARGAIPSYMKAAK
• Tested applications: ELISA, WB
• Clone Number: 2F3
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH12085

Detection limit for recombinant GST tagged STK38 is approximately 0.03 ng/ml as a capture antibody.

STK38 monoclonal antibody (M04), clone 2F3 Western Blot analysis of STK38 expression in Hela S3 NE.

STK38 monoclonal antibody (M04), clone 2F3. Western Blot analysis of STK38 expression in NIH/3T3.

STK38 monoclonal antibody (M04), clone 2F3. Western Blot analysis of STK38 expression in PC-12.

STK38 monoclonal antibody (M04), clone 2F3. Western Blot analysis of STK38 expression in Raw 264.7.

Western Blot analysis of STK38 expression in transfected 293T cell line by STK38 monoclonal antibody (M04), clone 2F3. Lane 1: STK38 transfected lysate(54.2 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of STK38 over-expressed 293 cell line, cotransfected with STK38 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with STK38 monoclonal antibody (M04) clone 2F3 (Cat # orb2291400). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (36.85 KDa).