You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291401 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant STK38. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a Kappa |
Conjugation | Unconjugated |
Reactivity | Human, Mouse, Rat |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | STK38 (AAH12085, 365 a.a. ~ 465 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | EHRIGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILKPTVATSNHPETDYKNKDWVFINYTYKRFEGLTARGAIPSYMKAAK |
Tested applications | ELISA, IHC-P, WB |
Clone Number | 6F1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH12085 |
Detection limit for recombinant GST tagged STK38 is approximately 0.1 ng/ml as a capture antibody.
Immunoperoxidase of monoclonal antibody to STK38 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1 ug/ml]
STK38 monoclonal antibody (M03), clone 6F1 Western Blot analysis of STK38 expression in Hela S3 NE.
STK38 monoclonal antibody (M03), clone 6F1. Western Blot analysis of STK38 expression in NIH/3T3.
STK38 monoclonal antibody (M03), clone 6F1. Western Blot analysis of STK38 expression in PC-12.
STK38 monoclonal antibody (M03), clone 6F1. Western Blot analysis of STK38 expression in Raw 264.7.
Western Blot detection against Immunogen (36.85 KDa).