You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291402 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant STK38. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | STK38 (AAH12085, 1 a.a. ~ 465 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | MAMTGSTPCSSMSNHTKERVTMTKVTLENFSSNLIAQHEEREMRQKKLEKVMEEEGLKDEEKRLRRSAHARKETEFLRLKRTRLGLEDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVGHIRAERDILVEADSLWVVKMFYSFQDKLNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSKGHVKLSDFGLCTGLKKAHRTEFYRNLNHSLPSDFTFQNMNSKRKAETWKRNRRQLAFSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYKKVMNWKETLTFPPEVPISEKAKDLILRFCCEWEHRIGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILKPTVAISNHPETDYKNKDWVFINYTYKRFEGLTARGAIPSYMKAAK |
Tested applications | ELISA, IF, IHC-P, IP, WB |
Clone Number | 2G8-1F3 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH12085 |
Detection limit for recombinant GST tagged STK38 is 0.1 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to STK38 on HeLa cell. [antibody concentration 10 ug/ml]
Immunoperoxidase of monoclonal antibody to STK38 on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B tissue [antibody concentration 5 ug/ml]
Immunoprecipitation of STK38 transfected lysate using anti-STK38 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with STK38 MaxPab rabbit polyclonal antibody.
STK38 monoclonal antibody (M01), clone 2G8-1F3 Western Blot analysis of STK38 expression in Hela S3 NE.
STK38 monoclonal antibody (M01), clone 2G8-1F3. Western Blot analysis of STK38 expression in human kidney.
Western Blot analysis of STK38 expression in transfected 293T cell line by STK38 monoclonal antibody (M01), clone 2G8-1F3. Lane 1: STK38 transfected lysate(54.2 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (76.89 KDa).