STK25 monoclonal antibody (M01), clone 1G6

• Catalog Number: orb2291553
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant STK25.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1G6
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: STK25 (AAH07852, 321 a.a. ~ 426 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: FPPTIRPSPHSKLHKGTALHSSQKPAEPVKRQPRSQCLSTLVRPVFGELKEKHKQSGGSVGALEELENAFSLAEESCPGISDKLMVHLVERVQRFSHNRNHLTSTR
• NCBI: AAH07852
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged STK25 is approximately 0.03 ng/ml as a capture antibody.

STK25 monoclonal antibody (M01), clone 1G6. Western Blot analysis of STK25 expression in HepG2.

Western Blot analysis of STK25 expression in transfected 293T cell line by STK25 monoclonal antibody (M01), clone 1G6. Lane 1: STK25 transfected lysate (Predicted MW: 48.1 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (37.29 KDa).