You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291470 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant STIP1. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a Kappa |
Conjugation | Unconjugated |
Reactivity | Human, Mouse, Rat |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | STIP1 (NP_006810.1, 445 a.a. ~ 543 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | TKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR |
Tested applications | ELISA, IF, IHC-P, WB |
Clone Number | 1E3 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_006810.1 |
Detection limit for recombinant GST tagged STIP1 is approximately 0.03 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to STIP1 on HeLa cell. [antibody concentration 10 ug/ml]
Immunoperoxidase of monoclonal antibody to STIP1 on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml]
STIP1 monoclonal antibody (M11), clone 1E3 Western Blot analysis of STIP1 expression in HeLa.
STIP1 monoclonal antibody (M11), clone 1E3. Western Blot analysis of STIP1 expression in NIH/3T3.
STIP1 monoclonal antibody (M11), clone 1E3. Western Blot analysis of STIP1 expression in PC-12.
STIP1 monoclonal antibody (M11), clone 1E3. Western Blot analysis of STIP1 expression in Raw 264.7.
Western Blot detection against Immunogen (36.63 KDa).