STIP1 monoclonal antibody (M11), clone 1E3

• Catalog Number: orb2291470
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant STIP1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1E3
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human, Mouse, Rat
• Isotype: IgG2a Kappa
• Immunogen: STIP1 (NP_006810.1, 445 a.a. ~ 543 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: TKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR
• NCBI: NP_006810.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged STIP1 is approximately 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to STIP1 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to STIP1 on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml]

STIP1 monoclonal antibody (M11), clone 1E3 Western Blot analysis of STIP1 expression in HeLa.

STIP1 monoclonal antibody (M11), clone 1E3. Western Blot analysis of STIP1 expression in NIH/3T3.

STIP1 monoclonal antibody (M11), clone 1E3. Western Blot analysis of STIP1 expression in PC-12.

STIP1 monoclonal antibody (M11), clone 1E3. Western Blot analysis of STIP1 expression in Raw 264.7.

Western Blot detection against Immunogen (36.63 KDa).