You have no items in your shopping cart.
Cart summary
STE11 Protein, S. cerevisiae, Recombinant
Catalog Number: orb1976463
| Catalog Number | orb1976463 |
|---|---|
| Category | Proteins |
| Description | Serine/threonine protein kinase required for cell-type-specific transcription and signal transduction in yeast. It is thought that it phosphorylates the STE7 protein kinase which itself, phosphorylates the FUS3 and or KSS1 kinases. STE11 Protein, S. cerevisiae, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 33.5 kDa and the accession number is P23561. |
| Tag | Tag Free |
| Purity | 98.00% |
| MW | 33.5 kDa (predicted) |
| UniProt ID | P23561 |
| Protein Sequence | WLKGACIGSGSFGSVYLGMNAHTGELMAVKQVEIKNNNIGVPTDNNKQANSDENNEQEEQQEKIEDVGAVSHPKTNQNIHRKMVDALQHEMNLLKELHHENIVTYYGASQEGGNLNIFLEYVPGGSVSSMLNNYGPFEESLITNFTRQILIGVAYLHKKNIIHRDIKGANILIDIKGCVKITDFGISKKLSPLNKKQNKRASLQGSVFWMSPEVVKQTATTAKADIWSTGCVVIEMFTGKHPFPDFSQMQAIFKIGTNTTPEIPSWATSEGKNFLRKAFELDYQYRPSALELLQHPWL |
| Expression System | E. coli |
| Biological Origin | Saccharomyces cerevisiae |
| Biological Activity | Serine/threonine protein kinase required for cell-type-specific transcription and signal transduction in yeast. It is thought that it phosphorylates the STE7 protein kinase which itself, phosphorylates the FUS3 and or KSS1 kinases. STE11 Protein, S. cerevisiae, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 33.5 kDa and the accession number is P23561. |
| Expression Region | 415-712 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expiration Date | 6 months from date of receipt. |
