You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb334628 |
---|---|
Category | Antibodies |
Description | Staufen/STAU1 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Gallus |
Reactivity | Human, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Staufen (532-568aa HGIGKDVESCHDMAALNILKLLSELDQQSTEMPRTGN), identical to the related mouse sequence. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.1-0.5μg/ml, Human, Rat |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 63182 MW |
UniProt ID | O95793 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Double-stranded RNA-binding protein Staufen homolo Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of Staufen/STAU1 using anti-Staufen/STAU1 antibody.Lane 1:human K562 cell;2:human HepG2 cell;3:human CACO-2 cell;4:human SiHa cell;5:human U20S cell;6:rat PC-12 cell.
Filter by Rating