Staufen/STAU1 Antibody

• Catalog Number: orb334628
• Category: Antibodies
• Description: Staufen/STAU1 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Gallus
• Reactivity: Human, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Staufen (532-568aa HGIGKDVESCHDMAALNILKLLSELDQQSTEMPRTGN), identical to the related mouse sequence.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Rat
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 63182 MW
• UniProt ID: O95793
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Double-stranded RNA-binding protein Staufen homolo
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of Staufen/STAU1 using anti-Staufen/STAU1 antibody.Lane 1:human K562 cell;2:human HepG2 cell;3:human CACO-2 cell;4:human SiHa cell;5:human U20S cell;6:rat PC-12 cell.