ST6GAL1 purified MaxPab rabbit polyclonal antibody (D01P)

• Catalog Number: orb2292180
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human ST6GAL1 protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human, Mouse
• Immunogen: ST6GAL1 (NP_775324.1, 1 a.a. ~ 175 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC
• NCBI: NP_775324.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

ST6GAL1 MaxPab rabbit polyclonal antibody. Western Blot analysis of ST6GAL1 expression in mouse liver.

Western Blot analysis of ST6GAL1 expression in transfected 293T cell line by ST6GAL1 MaxPab polyclonal antibody. Lane 1: ST6GAL1 transfected lysate (20.80 KDa). Lane 2: Non-transfected lysate.