ST3GAL2 monoclonal antibody (M01), clone 1E12

• Catalog Number: orb2292178
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ST3GAL2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1E12
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: ST3GAL2 (NP_008858, 28 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: HHSMATLPYLDSGALDGTHRVKLVPGYAGLQRLSKERLSGKSCACRRCMGDAGASDWFDSHFDGNISPVWTRENMDLPPDVQRWWMMLQPQFKSHNTNEV
• NCBI: NP_008858
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged ST3GAL2 is approximately 0.03 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to ST3GAL2 on formalin-fixed paraffin-embedded human tonsil tissue. [antibody concentration 1 ~ 10 ug/ml]

ST3GAL2 monoclonal antibody (M01), clone 1E12 Western Blot analysis of ST3GAL2 expression in K-562.

Western Blot analysis of ST3GAL2 expression in transfected 293T cell line by ST3GAL2 monoclonal antibody (M01), clone 1E12. Lane 1: ST3GAL2 transfected lysate (Predicted MW: 40.2 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).