You have no items in your shopping cart.
Cart summary
SSX1 Protein, Human, Recombinant (His & SUMO)
Catalog Number: orb1977964
| Catalog Number | orb1977964 |
|---|---|
| Category | Proteins |
| Description | Could act as a modulator of transcription. SSX1 Protein, Human, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 34.9 kDa and the accession number is Q16384. |
| Tag | N-6xHis-SUMO |
| Purity | 98.00% |
| MW | 34.9 kDa (predicted) |
| UniProt ID | Q16384 |
| Protein Sequence | MNGDDTFAKRPRDDAKASEKRSKAFDDIATYFSKKEWKKMKYSEKISYVYMKRNYKAMTKLGFKVTLPPFMCNKQATDFQGNDFDNDHNRRIQVEHPQMTFGRLHRIIPKIMPKKPAEDENDSKGVSEASGPQNDGKQLHPPGKANISEKINKRSGPKRGKHAWTHRLRERKQLVIYEEISDPEEDDE |
| Expression System | E. coli |
| Biological Origin | Human |
| Biological Activity | Could act as a modulator of transcription. SSX1 Protein, Human, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 34.9 kDa and the accession number is Q16384. |
| Expression Region | 1-188 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expiration Date | 6 months from date of receipt. |
