You have no items in your shopping cart.
Cart summary
SRSF1 Recombinant Protein (Human)
Catalog Number: orb2053923
| Catalog Number | orb2053923 |
|---|---|
| Category | Proteins |
| Description | SRSF1 Recombinant Protein (Human) |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 43.6 kDa |
| UniProt ID | Q07955 |
| Protein Sequence | SGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT |
| Source | E.coli |
| NCBI | NP_001071634 |
| Storage | -20°C or -80°C |
| Buffer/Preservatives | Liquid or Lyophilized powder |
| Alternative names | alternative-splicing factor 1;ASF;pre-mRNA-splicin Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Human SRSF1 protein [orb244537]
Greater than 90% as determined by SDS-PAGE.
43.6 kDa
E.coli
20 μg, 100 μg, 1 mgSRSF1 Recombinant Protein (Human) [orb2053922]
Greater than 90% as determined by SDS-PAGE.
43.6 kDa
E.coli
20 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
