You have no items in your shopping cart.
Cart summary
SRSF1 Protein, Human, Recombinant (His & SUMO)
Catalog Number: orb1977833
| Catalog Number | orb1977833 |
|---|---|
| Category | Proteins |
| Description | SRSF1 Protein, Human, Recombinant (His & SUMO) is expressed in E. coli. |
| Tag | N-6xHis-SUMO |
| Purity | 98.00% |
| Protein Sequence | SGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT |
| UniProt ID | Q07955 |
| MW | 43.6 kDa (predicted) |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expression System | E. coli |
| Biological Origin | Human |
| Biological Activity | SRSF1 Protein, Human, Recombinant (His & SUMO) is expressed in E. coli. |
| Expression Region | 2-248 aa |
| Storage | -20°C |
| Note | For research use only |
