You have no items in your shopping cart.
Cart summary
SRRM2 Protein, Human, Recombinant (His & Myc)
Catalog Number: orb1977834
| Catalog Number | orb1977834 |
|---|---|
| Category | Proteins |
| Description | SRRM2 Protein, Human, Recombinant (His & Myc) is expressed in Baculovirus. |
| Tag | N-10xHis, C-Myc |
| Purity | 98.00% |
| Protein Sequence | RTARRGSRSSPEPKTKSRTPPRRRSSRSSPELTRKARLSRRSRSASSSPETRSRTPPRHRRSPSVSSPEPAEKSRSSRRRRSASSPRTKTTSRRGRSPSPKPRGLQRSRSRSRREKTRTTRRRDRSGSSQSTSRRRQRSRSRSRVTRRRRGGSGYHSRSPARQESSRTSSRRRRGRSRTPPTSRKRSRSRTSPAPWKRSRSRASPATHRRSRSRTPLISRRRSRSRTSPVSRRRSRSRTSVTRRRSRSRASPVSRRRSRSRTPPVTRRRSRSRTPTTRRRSRSRTPPVTRRRSRSRTPPVTRRRSRSRTSPITRRRSRSRTSPVTRRRSRSRTSPVTRRRSRSRTSPVTRRRSRSRTPPAIRRRSRSRTPLLPRKRSRSRSPLAIRRRSRSRTPRTARGKRSLTRSPPAIRRRSASGSSSDRSR |
| UniProt ID | Q9UQ35 |
| MW | 53.8 kDa (predicted) |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expression System | Baculovirus Insect Cells |
| Biological Origin | Human |
| Biological Activity | SRRM2 Protein, Human, Recombinant (His & Myc) is expressed in Baculovirus. |
| Expression Region | 1666-2089 aa |
| Storage | -20°C |
| Note | For research use only |
