You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1977834 |
---|---|
Category | Proteins |
Description | SRRM2 Protein, Human, Recombinant (His & Myc) is expressed in Baculovirus. |
Tag | N-10xHis, C-Myc |
Purity | 98.00% |
Protein Sequence | RTARRGSRSSPEPKTKSRTPPRRRSSRSSPELTRKARLSRRSRSASSSPETRSRTPPRHRRSPSVSSPEPAEKSRSSRRRRSASSPRTKTTSRRGRSPSPKPRGLQRSRSRSRREKTRTTRRRDRSGSSQSTSRRRQRSRSRSRVTRRRRGGSGYHSRSPARQESSRTSSRRRRGRSRTPPTSRKRSRSRTSPAPWKRSRSRASPATHRRSRSRTPLISRRRSRSRTSPVSRRRSRSRTSVTRRRSRSRASPVSRRRSRSRTPPVTRRRSRSRTPTTRRRSRSRTPPVTRRRSRSRTPPVTRRRSRSRTSPITRRRSRSRTSPVTRRRSRSRTSPVTRRRSRSRTSPVTRRRSRSRTPPAIRRRSRSRTPLLPRKRSRSRSPLAIRRRSRSRTPRTARGKRSLTRSPPAIRRRSASGSSSDRSR |
UniProt ID | Q9UQ35 |
MW | 53.8 kDa (predicted) |
Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Expression System | Baculovirus Insect Cells |
Biological Origin | Human |
Biological Activity | SRRM2 Protein, Human, Recombinant (His & Myc) is expressed in Baculovirus. |
Expression Region | 1666-2089 aa |
Storage | -20°C |
Note | For research use only |