You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
SRGN monoclonal antibody (M03), clone 1D8
Catalog Number: orb2292352
| Catalog Number | orb2292352 |
|---|---|
| Category | Antibodies |
| Description | Mouse monoclonal antibody raised against a full-length recombinant SRGN. |
| Species/Host | Mouse |
| Clonality | Monoclonal |
| Clone Number | 1D8 |
| Tested applications | ELISA, WB |
| Reactivity | Human |
| Isotype | IgG2a Kappa |
| Immunogen | SRGN (AAH15516, 1 a.a. ~ 158 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Conjugation | Unconjugated |
| Protein Sequence | MMQKLLKCSRLVLALALILVLESSVQGYPTQRARYQWVRCNPDSNSANCLEEKGPMFELLPGESNKIPRLRTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDYQLVDESDAFHDNLRSLDRNLPSDSQDLGQHGLEEDFML |
| NCBI | AAH15516 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged SRGN is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (43.12 KDa).
