You have no items in your shopping cart.
Cart summary
SPRR2B Protein, Human, Recombinant (His & Myc)
Catalog Number: orb1977802
| Catalog Number | orb1977802 |
|---|---|
| Category | Proteins |
| Description | Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane. SPRR2B Protein, Human, Recombinant (His & Myc) is expressed in yeast with N-10xHis and C-Myc tag. The predicted molecular weight is 12.0 kDa and the accession number is P35325. |
| Tag | N-10xHis, C-Myc |
| Purity | 98.00% |
| MW | 12.0 kDa (predicted) |
| UniProt ID | P35325 |
| Protein Sequence | MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQPKYPPKSK |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Human |
| Biological Activity | Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane. SPRR2B Protein, Human, Recombinant (His & Myc) is expressed in yeast with N-10xHis and C-Myc tag. The predicted molecular weight is 12.0 kDa and the accession number is P35325. |
| Expression Region | 1-72 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
